Random-ness

Jun 24

Transformers: Revenge of the Fallen review

comicbooks:

This is mostly spoiler-free, unless you want to be surprised by dogs having sex.

When: Tuesday 12:01am
Where: Arclight Cinemas Cinerama Dome -Hollywood, CA
Viewed: NEC 2500 2K digital projection
Heard: Dolby Digital multi-channel surround sound

Transformers: Revenge of the Fallen

This was a good looking movie. Industrial Light & Magic, Digital Domain, Asylum… amazing SFX and VFX. Sound packed a hell of a punch, too.

Michael Bay (who was in attendance tonight and said a few words before the film started) and his team crafted a fine looking and sounding motion picture… but that’s where my praise ends.

Everything else; story, characters, dialogue, all the non-action, was fucking shite.

This was a big-budget feature and it showed: every minute cost millions of dollars, and Bay & co. made sure you know this. Every character was annoying; looking back all of their words in the film were incomprehensible wastes of time. Sam’s parents, his new friend, those annoying Stepin Fetchit-esque Autobots Mudflap and Skids, the Decepticon Wheelie, John Turturro, and even the US Military advanced nothing to the story that was required (or could even need). Can’t forget the family dogs that fuck for no damn reason.  The overall scope of the story gets lost in itself (or, it’s idea) rather quickly. After that, everything you expect to happen in the rest of the film does, in a very annoyingly slow manner that can only be justified that it was so Michael Bay could cram as many visuals as he could into 150 minutes! This film should’ve been no more 110 minutes… but that would’ve meant less cool locations, and less cool robots, and less Megan Fox.

I have defended Michael Bay may times, I think he’s a spectacular director with a massive vision who can assemble excellent production teams to make larger-than-life films… but this was too stupidly over-the-top, even for him. Of course, the beauty of Michael Bay is that he doesn’t give a fuck.

When Bay spoke prior to the movie beginning, he thanked us the fans and said this film was for us. Well… thanks Mr. Bay, but no thanks. I personally prefer to be a fan of good cinema than a fan of your Transformers.

Jun 23
Gay marriage chart…

Gay marriage chart…

Jun 23
New images of Alice in Wonderland

New images of Alice in Wonderland

Jun 18
annarexia:

(via funeralface)
Jun 17

postpunk:

Violent Femmes - Blister in the Sun (live)

Milwaukee’s finest.

Jun 16
The largest man-made hole in the world is a diamond mine located on the outskirts of Mirny, a small town in eastern Siberia. Begun in 1955, the pit is now 525 meters deep and 1.25 kilometers across. The massive 20-foot tall rock-hauling trucks that service the mine travel along a road that spirals down from the lip of the hole to its basin. Round-trip travel time: two hours. Airspace above the mine is off-limits to helicopters, after “a few accidents when they were ‘sucked in’ by downward air flow…”

The largest man-made hole in the world is a diamond mine located on the outskirts of Mirny, a small town in eastern Siberia. Begun in 1955, the pit is now 525 meters deep and 1.25 kilometers across. The massive 20-foot tall rock-hauling trucks that service the mine travel along a road that spirals down from the lip of the hole to its basin. Round-trip travel time: two hours. Airspace above the mine is off-limits to helicopters, after “a few accidents when they were ‘sucked in’ by downward air flow…”

Jun 16
I was watching the news this morning and I don’t think there is any doubt, anymore, that Iran’s current government has to some degree stolen the recent election. 1. There is no way that 40 million votes or ballots were counted by hand in less than twelve hours. 2. Mousavi lost the election in his home town. This is like if Obama would have lost in his home town of Chicago. 3. The landslide itself, 65% in favor of Ahmadinejad, please… Truth is, no matter what happens now this is the beginning of end. A large group of their voting population is now, like ours, youth. If by some horrible injustice this is allowed to stand in Iran this current government and/or  religious clerics are only delaying the inevitable. I am so glad to see the population of Iran by in large in protest and not taking this sitting down.

I was watching the news this morning and I don’t think there is any doubt, anymore, that Iran’s current government has to some degree stolen the recent election. 1. There is no way that 40 million votes or ballots were counted by hand in less than twelve hours. 2. Mousavi lost the election in his home town. This is like if Obama would have lost in his home town of Chicago. 3. The landslide itself, 65% in favor of Ahmadinejad, please… Truth is, no matter what happens now this is the beginning of end. A large group of their voting population is now, like ours, youth. If by some horrible injustice this is allowed to stand in Iran this current government and/or religious clerics are only delaying the inevitable. I am so glad to see the population of Iran by in large in protest and not taking this sitting down.

Jun 16
LINK: David Letterman Apologizes to Sarah Palin Again
 
 
 

Reports have surfaced that David Letterman offered yet another apology to Sarah Palin at this afternoon’s taping of his show set to air later tonight. He couldn’t have made a bigger mistake.
By apologizing again, not only is Letterman giving legitimacy to Palin’s ridiculous claims that his “perverted” jokes inspire sexual mistreatment of women, but it also breathes new life into an issue that had sort of fizzled out of the news cycle over the weekend. Besides, does he really think that Palin will ever accept any apology from him? Of course not! This will just give the media another opportunity to stick cameras and microphones in Palin’s face so she can continue to bray on and on and on about “David Letterman” being a dirty old man. He’d have been much better off ignoring it and letting all of this fade away, as it was already beginning to do, but instead he winds up essentially vindicating Palin’s unwarranted indignation instead.
Current.com

LINK: David Letterman Apologizes to Sarah Palin Again

Reports have surfaced that David Letterman offered yet another apology to Sarah Palin at this afternoon’s taping of his show set to air later tonight. He couldn’t have made a bigger mistake.

By apologizing again, not only is Letterman giving legitimacy to Palin’s ridiculous claims that his “perverted” jokes inspire sexual mistreatment of women, but it also breathes new life into an issue that had sort of fizzled out of the news cycle over the weekend. Besides, does he really think that Palin will ever accept any apology from him? Of course not! This will just give the media another opportunity to stick cameras and microphones in Palin’s face so she can continue to bray on and on and on about “David Letterman” being a dirty old man. He’d have been much better off ignoring it and letting all of this fade away, as it was already beginning to do, but instead he winds up essentially vindicating Palin’s unwarranted indignation instead.

Current.com

Jun 14

absurdlakefront:

I’m with Bill Maher on all accounts here.
YES!
Jun 12
Finally!
LINK: independentweekly.realviewtechnologies.com
Jun 12
“Star Craft” cake

“Star Craft” cake

Jun 12
brettjohn:
Nintendo Family Tree
Jun 11

Psyc Classes

I’m taking some summer classes at the local U. psyc classes that is and one is so not what I thought it was going to be about. “Sensation and Perception”, sounds fun huh? Tell you the truth I’ve no idea what I thought this class was going to be about, but if I did, it wouldn’t be about what it is. It turns out even though it is a Psyc class that it resembles more of a medical class.. great! yeah, that’s what I need this summer.

Jun 01

ZZZZzzzzz…

FIVE BEST THINGS TO SAY IF YOU GET CAUGHT SLEEPING AT YOUR DESK

NUMBER 5: “They told me at the Blood Bank this might happen.”

NUMBER 4: “This is just a 15 minute power nap they raved about in the
time-management course you sent me to.”

NUMBER 3: “Whew! Guess I left the top off the White-out. You probably got
here just in time!”

NUMBER 2: “Did you ever notice sound coming out of these keyboards when you
put your ear down real close?”

NUMBER 1: (Raising your head slowly) “…in Jesus’ name, Amen”

May 11
(via carlsmart)

(via carlsmart)